DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grh and GRHL3

DIOPT Version :9

Sequence 1:NP_476845.2 Gene:grh / 37038 FlyBaseID:FBgn0259211 Length:1333 Species:Drosophila melanogaster
Sequence 2:NP_937817.3 Gene:GRHL3 / 57822 HGNCID:25839 Length:626 Species:Homo sapiens


Alignment Length:533 Identity:168/533 - (31%)
Similarity:242/533 - (45%) Gaps:136/533 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 NIQQSFDYTELCQPGTLIDANGSIPVSVNSIQQRTAVH----GSQNS---PTTSLVDTSTNGSTR 876
            |:..:.:|.:|.:...|:...|::|....:........    ||.:|   |||.:.|   |||..
Human   116 NVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYD---NGSLN 177

  Fly   877 S-----------RPWHDFGRQNDA---DKIQIPKIFTNV------------------GFRYHLES 909
            |           :.|     |.|:   |..|...:|.::                  .|.|.|.|
Human   178 SLFESIHGVPPTQRW-----QPDSTFKDDPQESMLFPDILKTSPEPPCPEDYPSLKSDFEYTLGS 237

  Fly   910 PISSSQRREDDRITYINKGQFYGITLEYVHDAE-KPIKNTTVKSVIMLMFREEKSPEDEIKAWQF 973
            |.:...:..:..:.|:||||||.:||......: ..:.:..||||:|::|..||.|.::::.|:.
Human   238 PKAIHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSSNKVKSVVMVVFDNEKVPVEQLRFWKH 302

  Fly   974 WHSRQHSVKQRILD-ADTKNSVGLVGCIEEVSHNAIAVYWNPLESSAKINIAVQCLSTDFSSQKG 1037
            |||||.:.|||::| ||.|.:...|..||||::||::..|| :...||:.|.|.|||||||||||
Human   303 WHSRQPTAKQRVIDVADCKENFNTVEHIEEVAYNALSFVWN-VNEEAKVFIGVNCLSTDFSSQKG 366

  Fly  1038 VKGLPLHVQIDTFEDPRDT-AVFHRGYCQIKVFCDKGAERKTRDEERRAAKRKMTA--------- 1092
            |||:||::||||::....| .:.||..||||:|||||||||.||:||:..:||:..         
Human   367 VKGVPLNLQIDTYDCGLGTERLVHRAVCQIKIFCDKGAERKMRDDERKQFRRKVKCPDSSNSGVK 431

  Fly  1093 ----TGRKKLDELY-HPVTDRSEFYGMQDFAKPPVLFSPAEDMEKVGQLGIGAATGMTFNPLSNG 1152
                :|.:..:..| .|.|         |...|||||.|......:.:.| |||.       |.|
Human   432 GCLLSGFRGNETTYLRPET---------DLETPPVLFIPNVHFSSLQRSG-GAAP-------SAG 479

  Fly  1153 NSNSNSHSSLQSFYGHETDSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNML 1217
            .|:||.             .|..:..|||          |.:|.                     
Human   480 PSSSNR-------------LPLKRTCSPF----------TEEFE--------------------- 500

  Fly  1218 TSTPLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNAIENKYKISTTSI 1282
               ||     |.|:.:  ....:||:||||:|.|||:..|.:..|...||.|||..||.....:|
Human   501 ---PL-----PSKQAK--EGDLQRVLLYVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENI 555

  Fly  1283 NNIYRTNKKGITA 1295
            ..:|:..|:|.|:
Human   556 YKVYKKCKRGETS 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grhNP_476845.2 CP2 903..1089 CDD:282385 89/188 (47%)
GRHL3NP_937817.3 Transcription activation. /evidence=ECO:0000269|PubMed:12549979 30..95
CP2 210..421 CDD:282385 91/211 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 202 1.000 Domainoid score I2986
eggNOG 1 0.900 - - E1_KOG4091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001445
OrthoInspector 1 1.000 - - otm41194
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11037
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X907
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.