DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS2

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_014750.3 Gene:RGS2 / 854274 SGDID:S000005633 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:39/164 - (23%)
Similarity:72/164 - (43%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DGE----QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFW-LACEDLKKENSPEL 186
            ||:    ...|.::|   |...:.|:|....:.|..||:....|||:.|: .|.:.|:.:.:..:
Yeast    21 DGDAESSNTVLIQLR---KGHHERMRSPYTIQKFYKFLKRAHCEENLEFFEKAHQFLQLKQNRSI 82

  Fly   187 VEEKA-----RLIYEDYISILSPREVSLDSRVREIVNR---NMIEPTTHTFDEAQIQIY-TLMH- 241
            .|||.     :.:|..||::.||:|.:.....|||..:   |...|       |.:.:. .:.| 
Yeast    83 SEEKLLEVWNKSLYIKYIAVDSPKECNFSQDTREIFEKCFANNEVP-------ADVDVLCAISHV 140

  Fly   242 ----RDSYPRFLNSQKFKTLAQLQDNSNAGSKAD 271
                .|.|.||::|...|..:....::::.::.|
Yeast   141 MGLLMDGYHRFVSSVNEKKYSATYAHNDSATEQD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 33/131 (25%)
RGS2NP_014750.3 RGS 42..154 CDD:188659 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.