DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS5

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001241678.1 Gene:RGS5 / 8490 HGNCID:10001 Length:185 Species:Homo sapiens


Alignment Length:133 Identity:58/133 - (43%)
Similarity:90/133 - (67%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARL 193
            ::.:|:|...|..|.|||:::..|...|::||:|||||||:.||:||||.||..||..:.|||:.
Human    51 QKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQ 115

  Fly   194 IYEDYISILSPREVSL----DSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKF 254
            |||::|...:|:||.|    |...::|..:|::||:..:||.||.:|:.||.:||.|||:.|:.:
Human   116 IYEEFIQTEAPKEVGLWVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFY 180

  Fly   255 KTL 257
            :.|
Human   181 QEL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 55/120 (46%)
RGS5NP_001241678.1 RGS_RGS5 65..182 CDD:188672 53/116 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.