DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dhit and AXIN2

DIOPT Version :9

Sequence 1:	NP_611271.3	Gene:	Dhit / 37037	FlyBaseID:	FBgn0028743	Length:	274	Species:	Drosophila melanogaster
Sequence 2:	NP_004646.3	Gene:	AXIN2 / 8313	HGNCID:	904	Length:	843	Species:	Homo sapiens

Alignment Length:	121	Identity:	36/121 - (29%)
Similarity:	63/121 - (52%)	Gaps:	13/121 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   139 WGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEK----ARLIYEDYI 199
            |.||...|:....|..:|:.||..|...:.:.||.||...::.|   |.:.|    |:.||:.||
Human    78 WTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMN---LKDTKTLRVAKAIYKRYI 139

  Fly   200 ---SILSPR-EVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNS 251
               ||:|.: :.:..:.:|:.:.:..|:  :..||:||.:|.::|..::|..||.|
Human   140 ENNSIVSKQLKPATKTYIRDGIKKQQID--SIMFDQAQTEIQSVMEENAYQMFLTS 193

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dhit	NP_611271.3	RGS_RZ-like	139..256	CDD:188673	36/121 (30%)
AXIN2	NP_004646.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..75
		AXIN1_TNKS_BD	10..73	CDD:293252
		Tankyrase-binding motif	21..30
		RGS_Axin	82..198	CDD:188662	33/117 (28%)
		Interaction with GSK3B. /evidence=ECO:0000250	327..413
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	396..435
		Interaction with beta-catenin. /evidence=ECO:0000250	413..476
		Axin_b-cat_bind	432..467	CDD:285982
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	447..494
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	561..674
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	718..748
		DAX	761..843	CDD:197474
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3589
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810