Sequence 1: | NP_611271.3 | Gene: | Dhit / 37037 | FlyBaseID: | FBgn0028743 | Length: | 274 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011520984.1 | Gene: | AXIN1 / 8312 | HGNCID: | 903 | Length: | 916 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 55/206 - (26%) |
---|---|---|---|
Similarity: | 84/206 - (40%) | Gaps: | 34/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 PTVGGSVGILGSTSNVLQESNATTFQRPQSQKPCCFCWCCCCSCSWAKCLAIKNADENA-PTKRD 119
Fly 120 LVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSP 184
Fly 185 ELVEEK----ARLIYEDYI----SILSPR-EVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLM 240
Fly 241 HRDSYPRFLNS 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dhit | NP_611271.3 | RGS_RZ-like | 139..256 | CDD:188673 | 38/122 (31%) |
AXIN1 | XP_011520984.1 | Axin_TNKS_binding | 60..129 | CDD:211424 | 17/78 (22%) |
RGS_Axin | 138..258 | CDD:188662 | 36/118 (31%) | ||
Axin_b-cat_bind | 518..574 | CDD:285982 | |||
DIX | 836..911 | CDD:279160 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3589 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |