DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and AXIN1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_011520984.1 Gene:AXIN1 / 8312 HGNCID:903 Length:916 Species:Homo sapiens


Alignment Length:206 Identity:55/206 - (26%)
Similarity:84/206 - (40%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PTVGGSVGILGSTSNVLQESNATTFQRPQSQKPCCFCWCCCCSCSWAKCLAIKNADENA-PTKRD 119
            |.|.|..|.|.||                ..:|..:.:|.      .|.:.||.....| |.:.|
Human    72 PPVPGEEGELVST----------------DPRPASYSFCS------GKGVGIKGETSTATPRRSD 114

  Fly   120 LVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSP 184
            |......:|..........|.:|...|:....|..:|:.||:.|...:.:.||.||...:|....
Human   115 LDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPC 179

  Fly   185 ELVEEK----ARLIYEDYI----SILSPR-EVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLM 240
            :..|||    ||.||..||    .|:|.: :.:..|.::..:.:.:|:|.  .||:||.:|...|
Human   180 DSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA--MFDQAQTEIQATM 242

  Fly   241 HRDSYPRFLNS 251
            ..::||.||.|
Human   243 EENTYPSFLKS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 38/122 (31%)
AXIN1XP_011520984.1 Axin_TNKS_binding 60..129 CDD:211424 17/78 (22%)
RGS_Axin 138..258 CDD:188662 36/118 (31%)
Axin_b-cat_bind 518..574 CDD:285982
DIX 836..911 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.