DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and grid2ip

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_012826769.3 Gene:grid2ip / 780069 XenbaseID:XB-GENE-981804 Length:1275 Species:Xenopus tropicalis


Alignment Length:140 Identity:30/140 - (21%)
Similarity:50/140 - (35%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKAR 192
            |:|..|:|     |.|..|.:....|||                    :.|....|..|.:|...
 Frog   238 GDQSALKE-----KVFSLLKQYAQDRKV--------------------DTLANSLSMILTQESHH 277

  Fly   193 LIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            |:. |.|.|..|::..  .|...:|::::|.....:..:...::......|.:.|.|.|.:...:
 Frog   278 LLI-DNIRIFIPKKHR--QRFDNVVSQSLISKMCRSRSDRSNRLRRSRSEDHHERLLVSTRAAPI 339

  Fly   258 AQLQDNSNAG 267
            .|.||....|
 Frog   340 PQSQDEGGRG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 22/116 (19%)
grid2ipXP_012826769.3 PDZ_signaling 49..109 CDD:238492
PDZ_signaling 120..193 CDD:238492
harmonin_N_like 225..301 CDD:416392 21/90 (23%)
PDZ_signaling 368..443 CDD:238492
HN_L-delphilin-R2_like 478..557 CDD:259821
FH2 884..1252 CDD:396655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.