DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs12

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006504183.1 Gene:Rgs12 / 71729 MGIID:1918979 Length:1451 Species:Mus musculus


Alignment Length:183 Identity:60/183 - (32%)
Similarity:89/183 - (48%) Gaps:49/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DLVNAEFLDGE--------------------QPTLEEIR--------SWGKSFDKLMKSTAGRKV 155
            ||.:|...|||                    .|:::..|        ||..||::|::...|.:.
Mouse   664 DLESATVSDGELTGADLKDCISNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRY 728

  Fly   156 FQNFLRSEFSEENILFWLACEDL-------KKENSPELVEEKARLIYEDYISILSPREVSLDSRV 213
            |.:|||.||||||||||.|||..       |||     :..:||.|:..::...:...|::||:.
Mouse   729 FSDFLRKEFSEENILFWQACECFSHVPAHDKKE-----LSYRAREIFSKFLCSKATTPVNIDSQA 788

  Fly   214 R---EIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFK--TLAQLQ 261
            :   :|:|    .|....|.|.|:||:.||..|||.|||.||.::  .||:::
Mouse   789 QLADDILN----APHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECVLAEVE 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 49/128 (38%)
Rgs12XP_006504183.1 PDZ_signaling 19..95 CDD:238492
PTB_RGS12 227..358 CDD:269984
RGS_RGS12 716..830 CDD:188696 47/122 (39%)
RGS12_us1 836..949 CDD:374670 0/2 (0%)
RBD1_RGS12 962..1031 CDD:340656
Ubiquitin_like_fold 1032..1104 CDD:391949
RGS12_us2 1106..1180 CDD:374668
GoLoco 1189..1209 CDD:366965
RGS12_usC 1238..1361 CDD:374669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.