DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs10

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006508202.1 Gene:Rgs10 / 67865 MGIID:1915115 Length:185 Species:Mus musculus


Alignment Length:169 Identity:57/169 - (33%)
Similarity:86/169 - (50%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CWCCCCSCSWAKCLAIKNADENAPTKRDLVNAEFLDGE------QPTLEEIRSWGKSFDKLMKST 150
            ||..          .|.:....||   |.|..:..||:      ..:|:....|..|.:.|::..
Mouse     2 CWRA----------QIHSETAEAP---DSVLRDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDP 53

  Fly   151 AGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVRE 215
            .|.:.|:.||:.||||||:||||||||.||....:.::|||:.||..::|..:..:|:::.:.| 
Mouse    54 EGVQRFREFLKKEFSEENVLFWLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASSQVNVEGQSR- 117

  Fly   216 IVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKF 254
            :..:.:.||....|.:.|.||:.||..|||.|||.|..|
Mouse   118 LTEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 47/116 (41%)
Rgs10XP_006508202.1 RGS_RGS10 46..158 CDD:188695 45/112 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.