DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS10

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001005339.1 Gene:RGS10 / 6001 HGNCID:9992 Length:181 Species:Homo sapiens


Alignment Length:144 Identity:54/144 - (37%)
Similarity:83/144 - (57%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYE 196
            :|:....|..|.:.|::...|.|.|:.||:.||||||:||||||||.||......::|||:.||.
Human    31 SLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYM 95

  Fly   197 DYISILSPREVSLDSRVREIVNRNMI-EPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKF----KT 256
            .::|..:..:|:::.:.|  :|..:: ||....|.:.|.||:.||..|||.|||.|..|    :|
Human    96 TFLSSKASSQVNVEGQSR--LNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRT 158

  Fly   257 LAQLQDNSNAGSKA 270
            ..:.:|..:|.:.|
Human   159 EEEEEDLPDAQTAA 172

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 49/121 (40%)