DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS4

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001095915.1 Gene:RGS4 / 5999 HGNCID:10000 Length:302 Species:Homo sapiens


Alignment Length:281 Identity:88/281 - (31%)
Similarity:129/281 - (45%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GNGNGNGGGGGVVGGGGSLGGVS------PTVGGSVGILGSTS----NVLQESNATTFQRPQSQK 87
            |...|:.|.|........|.|.|      ||     |:.|..|    |:.....|...|......
Human    22 GEAEGDRGAGTAERSSDWLDGRSWAIKETPT-----GLAGRRSEDSDNIFTGEEAKYAQSRSHSS 81

  Fly    88 PCCFCWCCCCS------CSW-----AKCL------------AIKNAD----ENAPTKRDLVNAEF 125
            .|...:....|      |..     |.||            .::.:|    .::..|:|.|    
Human    82 SCRISFLLANSKLLNKMCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKV---- 142

  Fly   126 LDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEK 190
            :..::.:.||::.|.:|.:.|:....|...|:.||:||:|||||.||::||:.||..||..:..|
Human   143 VICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPK 207

  Fly   191 ARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFK 255
            |:.||.::||:.:.:||:|||..||..:|||:|||...|||||.:|:.||.:|||.|||.|:.:.
Human   208 AKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYL 272

  Fly   256 TLAQ-----LQDNSNAGSKAD 271
            .|..     .:....|.|.||
Human   273 DLVNPSSCGAEKQKGAKSSAD 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/116 (48%)
RGS4NP_001095915.1 RGS_RGS4 160..273 CDD:188669 54/112 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.