DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_002913.3 Gene:RGS1 / 5996 HGNCID:9991 Length:209 Species:Homo sapiens


Alignment Length:131 Identity:62/131 - (47%)
Similarity:85/131 - (64%) Gaps:2/131 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 EIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYI 199
            |:..|.:|.:||:.:..|:.||.:||:||||||||.|||||||.||..| :|:..||..||:.::
Human    78 EVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTES-DLLPCKAEEIYKAFV 141

  Fly   200 SILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKF-KTLAQLQDN 263
            ...:.:::::|.|.||...:.:..||...|||||..|||||.:|||||||.|..: ..|..||.|
Human   142 HSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQAN 206

  Fly   264 S 264
            |
Human   207 S 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/117 (48%)
RGS1NP_002913.3 RGS_RGS1 86..199 CDD:188670 54/113 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.