DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs2

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001025622.1 Gene:rgs2 / 595010 XenbaseID:XB-GENE-968776 Length:217 Species:Xenopus tropicalis


Alignment Length:151 Identity:66/151 - (43%)
Similarity:96/151 - (63%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NADENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWL 173
            |..:|   ||...||..    :||.||.:||.::||.|:.|..|...|:.||:||||||||.|||
 Frog    62 NMGQN---KRGKKNAYC----RPTPEEAKSWSETFDDLLASKYGVAAFRAFLKSEFSEENIEFWL 119

  Fly   174 ACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYT 238
            ||||.||..||..:..||:.||:::|...:|:|:::|.:.||.:.:.|.||:...|..||.::|:
 Frog   120 ACEDFKKTKSPHKLTAKAKKIYDEFIEKEAPKEINIDFQTRENIMQTMQEPSHSCFSAAQRRVYS 184

  Fly   239 LMHRDSYPRFLNSQKFKTLAQ 259
            ||..:|||||:.|:.::.|.|
 Frog   185 LMVNNSYPRFIQSEFYQELCQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 53/116 (46%)
rgs2NP_001025622.1 RGS_RGS2 89..202 CDD:188664 52/112 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.