DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs20

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001171266.1 Gene:Rgs20 / 58175 MGIID:1929866 Length:372 Species:Mus musculus


Alignment Length:217 Identity:113/217 - (52%)
Similarity:146/217 - (67%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GGGSLGGVSPTVGGSVGILGSTSNVLQESNATTFQRPQSQKPCCFCWCCCCSCSWAKCLAIKNAD 111
            ||....|.:|:..|..|           |||           |||||||||:||   ||.::|.:
Mouse   172 GGSETQGPAPSQQGGRG-----------SNA-----------CCFCWCCCCTCS---CLTVRNQE 211

  Fly   112 ENAP------TKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENIL 170
            :..|      .:.|:...|  :...|||||:.:|.:|||.||.:.|||..|:.|||:||||||:|
Mouse   212 DQRPQRASHEIRTDIPACE--ESPTPTLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENML 274

  Fly   171 FWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQ 235
            ||:|||:||:|.:...:|||||:|||||||||||:||||||||||::||||::|:.|.||:||:|
Mouse   275 FWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQ 339

  Fly   236 IYTLMHRDSYPRFLNSQKFKTL 257
            |||||||||||||:||..:|.|
Mouse   340 IYTLMHRDSYPRFMNSTVYKDL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 80/116 (69%)
Rgs20NP_001171266.1 RGS 205..360 CDD:295367 90/156 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3487
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I3409
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47786
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm43970
orthoMCL 1 0.900 - - OOG6_103880
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3135
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.