DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and axin1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_009297983.1 Gene:axin1 / 57931 ZFINID:ZDB-GENE-000403-1 Length:871 Species:Danio rerio


Alignment Length:160 Identity:46/160 - (28%)
Similarity:79/160 - (49%) Gaps:13/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AKCLAIKN-ADENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFS 165
            :|..::|| |....|.:.||......:|..........|.:|...|:....|..:|:.||:.|..
Zfish    51 SKSDSLKNEASIATPRRPDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEEC 115

  Fly   166 EENILFWLACEDLKKE---NSPELVEEKARLIYEDYI----SILSPREV--SLDSRVREIVNRNM 221
            .:.:.||.||...:|:   :..|.:.:.|:.||:.||    .|:| |::  :..|.:::.|.:..
Zfish   116 ADMLDFWFACSGFRKQEANDGNEKMLKLAKAIYKKYILDNNGIVS-RQIKPATKSFIKDCVMKLH 179

  Fly   222 IEPTTHTFDEAQIQIYTLMHRDSYPRFLNS 251
            |:|.  .||:||.:|.|:|..::||.||.|
Zfish   180 IDPA--MFDQAQTEIQTMMEENTYPLFLKS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 38/122 (31%)
axin1XP_009297983.1 Axin_TNKS_binding 15..84 CDD:211424 8/32 (25%)
RGS_Axin 93..212 CDD:188662 36/118 (31%)
DUF507 368..>427 CDD:321349
Axin_b-cat_bind 469..504 CDD:312391
DIX 791..866 CDD:307085
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.