DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs4

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_954968.1 Gene:rgs4 / 569876 ZFINID:ZDB-GENE-030131-9839 Length:215 Species:Danio rerio


Alignment Length:189 Identity:75/189 - (39%)
Similarity:99/189 - (52%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PQSQKPCCFCWCCCCSCSWAKCLAIKNAD---ENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFD 144
            ||.||                  |:|..:   :....|..:||       :.|..|...|..||.
Zfish    33 PQEQK------------------ALKEKEKEKDKEKVKDTVVN-------RITPAETEKWKTSFT 72

  Fly   145 KLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSL 209
            .|:|:..|||.|.:||:||:|:|||.||:||||. |:...:.:..|||.|:|.||...|||||:|
Zfish    73 NLIKNDDGRKAFASFLQSEYSQENIEFWVACEDF-KQTPADKMNLKARNIFERYIEADSPREVNL 136

  Fly   210 DSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQ-LQDNSNAG 267
            ||..||...:|:.......|||||.:|:|||.:|||.|||.|:.|..|:| ..||...|
Zfish   137 DSVTREQTRKNLEMCDVSCFDEAQSKIFTLMEKDSYRRFLRSRLFLELSQPAMDNKPCG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 59/116 (51%)
rgs4NP_954968.1 RGS 71..183 CDD:295367 57/112 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.