DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs19

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001278134.1 Gene:Rgs19 / 56470 MGIID:1915153 Length:243 Species:Mus musculus


Alignment Length:188 Identity:104/188 - (55%)
Similarity:131/188 - (69%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PQSQKPCCFCWCCCCSCSW-------------AKCLAIKNADENAPTKRDLVNAEFLDGEQPTLE 134
            |.|:.|||.||||||||||             :|...:.:.:...|               |:.:
Mouse    60 PPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTP---------------PSPK 109

  Fly   135 EIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYI 199
            |::||.:||||||.|..||.||:.|||:|:||||:|||||||:||.|.:..:|:||||||||||:
Mouse   110 EVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYV 174

  Fly   200 SILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            |||||:||||||||||.:||.|.||:.||||:||:|||||||||||||||.|..:::|
Mouse   175 SILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 83/116 (72%)
Rgs19NP_001278134.1 RGS_RGS19 114..231 CDD:188699 83/116 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47786
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm43970
orthoMCL 1 0.900 - - OOG6_103880
Panther 1 1.100 - - LDO PTHR10845
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.