DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs6

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001030340.1 Gene:rgs6 / 562667 ZFINID:ZDB-GENE-030131-31 Length:489 Species:Danio rerio


Alignment Length:129 Identity:52/129 - (40%)
Similarity:83/129 - (64%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARL 193
            :.|:.:.::.||.|.|:.:|...||:.|..||.||||.||:|||||.:|||.....| |..:|:.
Zfish   322 KDPSQQRVKKWGFSLDEALKDPVGREQFLKFLESEFSSENLLFWLAVQDLKCRPLQE-VASRAQE 385

  Fly   194 IYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            |::::::..:|..::|||...|..::|:.:|..::|::||..||.||..|||||||.|..::.|
Zfish   386 IWQEFLAEGAPNAINLDSHSYERTSQNLKDPGRYSFEDAQDHIYKLMKSDSYPRFLRSNAYQDL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 50/116 (43%)
rgs6NP_001030340.1 DEP_RGS7-like 31..118 CDD:239897
GGL 257..318 CDD:128520
RGS_RGS6 327..451 CDD:188691 51/124 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.