DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs7

DIOPT Version :10

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_062216.1 Gene:Rgs7 / 54296 RGDID:3570 Length:477 Species:Rattus norvegicus


Alignment Length:131 Identity:52/131 - (39%)
Similarity:83/131 - (63%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARL 193
            ::|:.:.::.||...|:.:|...||:.|..||.||||.||:.||||.|||||....| |..:.:.
  Rat   320 KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIRE-VPSRVQE 383

  Fly   194 IYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLA 258
            |::::::..:|..::|||:..:...:|:.||..:||::||..||.||..||||||:.|..::.|.
  Rat   384 IWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELL 448

  Fly   259 Q 259
            |
  Rat   449 Q 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 49/116 (42%)
Rgs7NP_062216.1 DEP_RGS7-like 29..116 CDD:239897
RGS_DHEX 113..214 CDD:375589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..257
GGL 256..316 CDD:128520
RGS_RGS7 326..446 CDD:188692 49/120 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.