DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs5

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_062214.1 Gene:Rgs5 / 54294 RGDID:3568 Length:181 Species:Rattus norvegicus


Alignment Length:128 Identity:62/128 - (48%)
Similarity:94/128 - (73%) Gaps:0/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLI 194
            :|:|||:..|.:|.|||::|..|...|::||:|||||||:.||:|||:.||..||..:.|||:.|
  Rat    52 KPSLEEVLQWRQSLDKLLQSNYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQI 116

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            ||::|...:|:||::|...::|..:|::||:.|:||.||.:||.||.:||.|||:.|:.:|.|
  Rat   117 YEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPHSFDLAQKRIYALMEKDSLPRFVRSEFYKEL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/116 (48%)
Rgs5NP_062214.1 RGS_RGS5 65..178 CDD:188672 54/112 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.