DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs3

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_017449084.1 Gene:Rgs3 / 54293 RGDID:3566 Length:1144 Species:Rattus norvegicus


Alignment Length:360 Identity:99/360 - (27%)
Similarity:134/360 - (37%) Gaps:120/360 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCTVSELPSGCR-------LRGMTASSQQSAANNSGNNGNGNGNGGGGGVVG------------- 46
            :.|..| ||..|       :|..:|.|||..|:...:..:.:...|..|..|             
  Rat   791 AATAGE-PSASRPNFVIPEVRLDSAYSQQDGAHGGSSGEDEDAEEGEEGEEGEEDEEDDTSDDNY 854

  Fly    47 --------------GGGSLGGVSPTVGGSV-GILGSTSNVLQESNATTFQRPQSQKPCCFCWCCC 96
                          |.|:.||:|..|..|: ....|..::|||:...           ||.....
  Rat   855 GDRNEAKRSSLIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEARGP-----------CFASDTT 908

  Fly    97 CSCS--------WA--------------------------------------------------- 102
            ..||        ||                                                   
  Rat   909 LHCSDGEGTTSTWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGTDLADDVEASRKRKSKNI 973

  Fly   103 -----KCLAIKNADENAP-----TKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQ 157
                 ..|||......:|     .|.|.....|    :||.||...|.:|.:||:....|.:|||
  Rat   974 AKDMKNKLAIFRRRNESPGAQPAGKADKTTKSF----KPTSEEALKWSESLEKLLLHKYGLEVFQ 1034

  Fly   158 NFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMI 222
            .|||:||||||:.|||||||.||..|...:..||:.|:.::|:|.:.:||:|||..||....|:.
  Rat  1035 AFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQ 1099

  Fly   223 EPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            ..|...||.||.:|:.||.:|||||||.|..:..|
  Rat  1100 SITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDL 1134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/116 (48%)
Rgs3XP_017449084.1 C2_RGS-like 35..154 CDD:176067
PDZ_signaling 195..268 CDD:238492
PHA03307 578..>802 CDD:223039 4/11 (36%)
RGS_RGS3 1020..1133 CDD:188668 54/112 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.