DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006250036.1 Gene:Rgs1 / 54289 RGDID:3561 Length:209 Species:Rattus norvegicus


Alignment Length:148 Identity:61/148 - (41%)
Similarity:89/148 - (60%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKEN 182
            :|:::|          ||:..|.:|.:||:.:..|:.||..||:||||||||.|||||||.||..
  Rat    71 KDILSA----------EEVMQWSQSLEKLLANQMGQNVFGKFLKSEFSEENIEFWLACEDYKKTE 125

  Fly   183 SPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPR 247
            : :|:..||..||:.::...:.:::::|...||...:.:..||...|||||..||.||.:|||||
  Rat   126 T-DLLHNKAEHIYKAFVHSDAVKQINIDFHTRESTAKKIKTPTPTCFDEAQKVIYALMEKDSYPR 189

  Fly   248 FLNSQKF-KTLAQLQDNS 264
            ||.|..: ..|..||.|:
  Rat   190 FLKSNIYLNLLNDLQANT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 53/117 (45%)
Rgs1XP_006250036.1 RGS 86..199 CDD:413378 51/113 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.