DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs11

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001074538.1 Gene:Rgs11 / 50782 MGIID:1354739 Length:466 Species:Mus musculus


Alignment Length:132 Identity:49/132 - (37%)
Similarity:75/132 - (56%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLK---KENSPELVEEKAR 192
            ||...:..|..||.:|:....||..|.:||:.|||.||:.||.|||:|:   :...|.||:.   
Mouse   292 PTKLRVERWSFSFRELLDDPVGRAHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDS--- 353

  Fly   193 LIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
             :|:.:::..:.|.:::|||..|.....:.:|..:..|.||:.||.||.:|||||||.|..:|.|
Mouse   354 -VYQQFLAPGAARWINIDSRTMERTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGL 417

  Fly   258 AQ 259
            .:
Mouse   418 LE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 45/119 (38%)
Rgs11NP_001074538.1 DEP_RGS7-like 26..113 CDD:239897
GGL 224..284 CDD:128520
RGS 295..420 CDD:295367 47/129 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.