DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002939124.3 Gene:rgs1 / 496714 XenbaseID:XB-GENE-968765 Length:239 Species:Xenopus tropicalis


Alignment Length:208 Identity:77/208 - (37%)
Similarity:115/208 - (55%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GILGSTSNVLQE-SNATTFQRPQSQKPCCFCWCCCCSCSWAKCLA--IKNADENAPTKRDLVNAE 124
            ||..|.:|.|:| .|.......|.:|            ::|..|.  :|:...:..|.:...:..
 Frog    41 GIFFSHANALKEVDNKPDEVMAQKKK------------NFAVDLKNYLKSMLPHLETMKSSSSTS 93

  Fly   125 FLDGEQPTL--EEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELV 187
            ..|.|:..|  :||..|..|.:||:.|..|:.||:.||:||||||||.|||||||.|..|..|.:
 Frog    94 SSDSEKNKLTPDEIIQWTMSLEKLLISEDGQSVFREFLKSEFSEENIEFWLACEDYKATNDSEEL 158

  Fly   188 EEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQ 252
            ..||.:||:::|...:.:::::|...|..|.::::|||..||::||..|:.||.||||||||.|:
 Frog   159 RCKANVIYQEFIQPNANKQINIDFSTRNSVTKDLLEPTITTFNDAQKMIFILMERDSYPRFLKSE 223

  Fly   253 KFKTLAQLQDNSN 265
            .|..||:....:|
 Frog   224 IFLRLAERHHGNN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/116 (48%)
rgs1XP_002939124.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.