DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs18

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001008092.1 Gene:rgs18 / 493454 XenbaseID:XB-GENE-5747705 Length:235 Species:Xenopus tropicalis


Alignment Length:143 Identity:62/143 - (43%)
Similarity:93/143 - (65%) Gaps:9/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDY 198
            ||...||:|||||:....|.:.|:.||:.|||:||:.|||.||:.||..:.:.:::||:.:||.|
 Frog    76 EEAMKWGESFDKLLSHKDGIEAFKKFLKMEFSDENLEFWLECEEYKKCQTNKQMDDKAKSLYEKY 140

  Fly   199 ISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQLQDN 263
            |.:.|||||:||...:|:..:::.:|...:||.||.:||:||.:|||||||.|..:       .|
 Frog   141 IQMDSPREVNLDFATKEMTKKSIEQPELTSFDLAQTKIYSLMEKDSYPRFLKSSVY-------SN 198

  Fly   264 SNAGSK--ADSPT 274
            |.:|::  |..||
 Frog   199 SLSGNQRIASFPT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 54/116 (47%)
rgs18NP_001008092.1 RGS 85..198 CDD:383028 51/119 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.