DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs3a

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_009300312.2 Gene:rgs3a / 445235 ZFINID:ZDB-GENE-040801-150 Length:896 Species:Danio rerio


Alignment Length:196 Identity:73/196 - (37%)
Similarity:99/196 - (50%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CSCSWAKCLAIKNADENAPTKRDLVN----------------AEFLD----GEQPTLEEIRSWGK 141
            |||........|...:|  ..:|:.|                |..||    ..:||.||...||:
Zfish   703 CSCDVGPDGTKKKKSKN--LAKDMKNRLAFLRRRNESPGSTPASKLDKTMKSVKPTPEEAMKWGE 765

  Fly   142 SFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPRE 206
            |.|||:....|...|:.|||:||||||:.|||||||.||..|...:..||:.|:.::|:|.|.:|
Zfish   766 SLDKLLVHKYGLAAFRAFLRTEFSEENLDFWLACEDYKKIKSQSKMTSKAKKIFAEFIAIQSCKE 830

  Fly   207 VSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQLQDNSNAGSKAD 271
            |:|||..||....|:.......|:.||.:||.||.:|||||||.|:.:..|...:..|...:.:.
Zfish   831 VNLDSYTREHTKENLQNINRSCFELAQRRIYGLMEKDSYPRFLRSELYMDLVNQKKPSTTSTSSS 895

  Fly   272 S 272
            |
Zfish   896 S 896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/116 (48%)
rgs3aXP_009300312.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.