DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs20

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_005163483.1 Gene:rgs20 / 436704 ZFINID:ZDB-GENE-040718-128 Length:297 Species:Danio rerio


Alignment Length:249 Identity:127/249 - (51%)
Similarity:163/249 - (65%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ANNSGNNGNGNGNGGGGGVVGGGGSLGGVS--PTVGGSVGILGSTSNVLQESNATTFQRPQSQKP 88
            ||.|..|.:.|.|       ...||...:|  |.....:.:.....:|.|||.|.|....|:::|
Zfish    47 ANGSYENEDENEN-------TEDGSKDPISFQPMGSERMEMRKRQMSVQQESVAGTTAPAQNEQP 104

  Fly    89 ---------CCFCWCCCCSCSWAKCLAIKNADENAPTKRDLV------NAEFLDGEQPTLEEIRS 138
                     ||||||||||||   ||.::|.|.:...:|...      :|:|.:..:||.|||..
Zfish   105 GQGNRASNACCFCWCCCCSCS---CLTVRNEDRDERNRRASYDFKADGDADFEESPKPTAEEICL 166

  Fly   139 WGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILS 203
            ||:||||||...:||..|:.|||:||||||:|||||||:.:||.:..::|||||:||||||||||
Zfish   167 WGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVIEEKARIIYEDYISILS 231

  Fly   204 PREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            |:||||||||||::||||:|||:||||:||:||||||.|||||||:||..:|.|
Zfish   232 PKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRFMNSPVYKNL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 83/116 (72%)
rgs20XP_005163483.1 RGS_RGS20 127..284 CDD:188700 94/156 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 181 1.000 Domainoid score I3424
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3309
OMA 1 1.010 - - QHG47786
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm26372
orthoMCL 1 0.900 - - OOG6_103880
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3135
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.