DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dhit and GRID2IP

DIOPT Version :9

Sequence 1:	NP_611271.3	Gene:	Dhit / 37037	FlyBaseID:	FBgn0028743	Length:	274	Species:	Drosophila melanogaster
Sequence 2:	NP_001138590.1	Gene:	GRID2IP / 392862	HGNCID:	18464	Length:	1211	Species:	Homo sapiens

Alignment Length:	87	Identity:	24/87 - (27%)
Similarity:	37/87 - (42%)	Gaps:	19/87 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   104 CLAIKNADENAPTKRDLVNAEFLDGEQPTL--------EEIRSWGKS---FDKLMKSTAGRKVFQ 157
            |.:|..:.|:   |..:|.:.||:..||.|        |.:...||:   |.:..|:|.....|.
Human  1117 CQSISPSSED---KFAMVMSSFLETAQPALRALDGLQREAMEELGKALAFFGEDSKATTSEAFFG 1178

  Fly   158 NFLRSEFSEENILFWLACEDLK 179
            .|  :||..:   |..|..||:
Human  1179 IF--AEFMSK---FERALSDLQ 1195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dhit	NP_611271.3	RGS_RZ-like	139..256	CDD:188673	13/44 (30%)
GRID2IP	NP_001138590.1	PDZ_signaling	14..74	CDD:238492
		HN_L-delphilin-R1_like	133..212	CDD:259820
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	226..269
		PDZ_signaling	278..353	CDD:238492
		HN_L-delphilin-R2_like	389..468	CDD:259821
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	478..502
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	525..549
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	568..600
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	618..672
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	718..783
		FH2	820..1188	CDD:280362	20/78 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3589
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900