DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs12b

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_999889.1 Gene:rgs12b / 378970 ZFINID:ZDB-GENE-031006-13 Length:1540 Species:Danio rerio


Alignment Length:178 Identity:56/178 - (31%)
Similarity:85/178 - (47%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DLVNAEFLDGE----------------------------QPTLEEIRSWGKSFDKLMKSTAGRKV 155
            ||.:|...|||                            :.|...:.||...|::|::...|.:.
Zfish   689 DLESAAVSDGELNSVDLKGCGSDNSLNSNASLPSVQCHRRHTERRVASWAVCFERLLQDPVGVRY 753

  Fly   156 FQNFLRSEFSEENILFWLACEDLK--KENSPELVEEKARLIYEDYISILSPREVSLDSRVR---E 215
            |..||:.||||||||||.|||...  .|...:.:.::||.||..::|..:...|::||:.:   :
Zfish   754 FSEFLKKEFSEENILFWQACEYFSHVPETDKKQLSQRAREIYNSFLSSKATTPVNIDSQAQLADD 818

  Fly   216 IVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFK--TLAQLQ 261
            |:|    .|....|.|.|:||:.||..|||.|||.|..::  .||:::
Zfish   819 ILN----APRPDMFKEQQLQIFNLMKFDSYTRFLKSYLYQECMLAEVE 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 46/123 (37%)
rgs12bNP_999889.1 PDZ_signaling 20..96 CDD:238492
PTB_RGS12 239..372 CDD:269984
RGS_RGS12 741..855 CDD:188696 45/117 (38%)
RGS12_us1 861..954 CDD:293219 0/2 (0%)
RGS12_RBD 993..1065 CDD:176412
UBQ 1065..1132 CDD:294102
RGS12_us2 1141..>1180 CDD:293217
GoLoco 1195..1216 CDD:280368
RGS12_usC <1307..1367 CDD:293218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.