DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and CG42450

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster


Alignment Length:182 Identity:53/182 - (29%)
Similarity:85/182 - (46%) Gaps:31/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPE 185
            :|..|:|  .||.:.::.|..|.::|:....|.:.|..||..|:|.|||.||:|...|:: ::..
  Fly   482 LNNTFVD--IPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRR-SAHS 543

  Fly   186 LVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIY-TLMHRDSYPRFL 249
            .|..|...|||:::...:|.|:::|.:..|.|.:.:..|:..|||.|...|| .|:.:|.||||:
  Fly   544 QVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFI 608

  Fly   250 NSQKFKTL---------------------------AQLQDNSNAGSKADSPT 274
            .|:.:|.|                           |.|....|.|..|..|:
  Fly   609 RSEHYKRLLDTGIQPSYKKRFFNFGGVSGAKKKMTAALSSQPNLGDAAKGPS 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 40/117 (34%)
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
G-gamma 422..482 CDD:279025 53/182 (29%)
RGS_R7-like 494..614 CDD:188660 40/120 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.