DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs14a

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_009305919.2 Gene:rgs14a / 327368 ZFINID:ZDB-GENE-030131-5579 Length:554 Species:Danio rerio


Alignment Length:120 Identity:50/120 - (41%)
Similarity:69/120 - (57%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEK--ARLIYEDYIS 200
            ||...|:.|::...|.:.|..|||||.|.|||||:.|||..||..:..|.|.|  |||||:.::|
Zfish   104 SWAVCFEHLLEDHVGVRYFTEFLRSEVSAENILFYQACEKFKKIPTSRLEEMKKEARLIYDTFLS 168

  Fly   201 ILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFK 255
            ..|...|::|. ..:...|.:..||...|::||.||:.||..|||.||:.|..::
Zfish   169 ESSLHAVNIDD-TAQTEERELEMPTPDMFNKAQAQIFKLMKMDSYTRFVRSPLYQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 49/119 (41%)
rgs14aXP_009305919.2 RGS_R12-like 109..223 CDD:188661 48/115 (42%)
RGS12_RBD 343..415 CDD:176412
TGS 423..483 CDD:330245
GoLoco 508..529 CDD:308026
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.