DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs17

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001100929.1 Gene:Rgs17 / 308118 RGDID:1305515 Length:210 Species:Rattus norvegicus


Alignment Length:208 Identity:113/208 - (54%)
Similarity:152/208 - (73%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ESNATTFQRPQSQKP---CCFCWCCCCSCSWAKCLAIKNADE-----NAPTKRDLVNAEFLDG-E 129
            |......|.|.:|:|   ||||||||||||   ||.::|.:.     ..|....:.:.:.|:. :
  Rat    10 EGTQAVSQAPGNQRPNNTCCFCWCCCCSCS---CLTVRNEERGDSSGRPPHTTKMESIQVLEECQ 71

  Fly   130 QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLI 194
            .||.:|:.||.::|||:||:.|||.:|:.|||:|:||||:||||||||||||.:.:.||||||:|
  Rat    72 NPTADEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMI 136

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQ 259
            ||||||||||:||||||||||::|||::||:.|.:::||:||||||||||:|||||||.:|...:
  Rat   137 YEDYISILSPKEVSLDSRVREVINRNLLEPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVE 201

  Fly   260 LQDNSNAGSKADS 272
                |.|.|.::|
  Rat   202 ----STASSTSES 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 82/116 (71%)
Rgs17NP_001100929.1 RGS 41..197 CDD:413378 90/155 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354342
Domainoid 1 1.000 183 1.000 Domainoid score I3344
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8242
Inparanoid 1 1.050 237 1.000 Inparanoid score I3297
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm46060
orthoMCL 1 0.900 - - OOG6_103880
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.660

Return to query results.
Submit another query.