DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs4

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_058910.1 Gene:Rgs4 / 29480 RGDID:3567 Length:205 Species:Rattus norvegicus


Alignment Length:161 Identity:66/161 - (40%)
Similarity:99/161 - (61%) Gaps:9/161 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKK 180
            :|:|.|    :..::.:.||::.|.:|.:.|:....|...|:.||:||:|||||.||::||:.||
  Rat    40 SKKDKV----VTCQRVSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKK 100

  Fly   181 ENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSY 245
            ..||..:..||:.||.::||:.:.:||:|||..||..:|||:|||...|||||.:|:.||.:|||
  Rat   101 IKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSY 165

  Fly   246 PRFLNSQKFKTLAQ-----LQDNSNAGSKAD 271
            .|||.|:.:..|..     .:....|.|.||
  Rat   166 RRFLKSRFYLDLTNPSSCGAEKQKGAKSSAD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 56/116 (48%)
Rgs4NP_058910.1 RGS_RGS4 63..176 CDD:188669 54/112 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.