DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs18

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001040549.1 Gene:Rgs18 / 289076 RGDID:1306522 Length:235 Species:Rattus norvegicus


Alignment Length:126 Identity:57/126 - (45%)
Similarity:82/126 - (65%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDY 198
            ||...|.:|||||:....|...|..||::|||||||.||:||||.||...|:.:..||:.|||.:
  Rat    78 EEALKWAESFDKLLSHRDGVDAFTRFLKTEFSEENIEFWVACEDFKKCTEPQQLILKAKSIYEKF 142

  Fly   199 ISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQ 259
            |...:|:||:||...:|::.:::.:||.|:||.||.::..||..|||.|||.|:.:..|.:
  Rat   143 IKNDAPKEVNLDFHTKEVITKSIAQPTLHSFDAAQSRVCQLMEHDSYKRFLKSEIYLHLIE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 54/116 (47%)
Rgs18NP_001040549.1 RGS 87..199 CDD:295367 52/111 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.