DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Grid2ip

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006248928.1 Gene:Grid2ip / 288484 RGDID:1310492 Length:1203 Species:Rattus norvegicus


Alignment Length:84 Identity:24/84 - (28%)
Similarity:34/84 - (40%) Gaps:19/84 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PTKRD---LVNAEFLDGEQPTL--------EEIRSWGKS---FDKLMKSTAGRKVFQNFLRSEFS 165
            |:..|   :|...||:..||.|        |.:...||:   |.:..|:|.....|..|  |||.
  Rat  1114 PSSEDRFAVVMTSFLETAQPALRALDGLQREAMEELGKALAFFGEDSKATTSEAFFGIF--SEFM 1176

  Fly   166 EENILFWLACEDLKKENSP 184
            .:   |..|..||:..:.|
  Rat  1177 SK---FERALSDLQAGDGP 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 15/49 (31%)
Grid2ipXP_006248928.1 PDZ_signaling 9..69 CDD:238492
HN_L-delphilin-R1_like 122..201 CDD:259820
PDZ_signaling 269..342 CDD:238492
HN_L-delphilin-R2_like 378..457 CDD:259821
FH2 812..1180 CDD:280362 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.