DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS17

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_036551.3 Gene:RGS17 / 26575 HGNCID:14088 Length:210 Species:Homo sapiens


Alignment Length:209 Identity:116/209 - (55%)
Similarity:156/209 - (74%) Gaps:18/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ESNATTFQRPQSQKP---CCFCWCCCCSCSWAKCLAIKNAD--ENA-----PTKRDLVNAEFLDG 128
            |......|.|.:|:|   ||||||||||||   ||.::|.:  |||     .||.:.:.. ..:.
Human    10 EGTPAVSQAPGNQRPNNTCCFCWCCCCSCS---CLTVRNEERGENAGRPTHTTKMESIQV-LEEC 70

  Fly   129 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARL 193
            :.||.||:.||.::|||:||:.|||.:|:.|||:|:||||:||||||||||||.:.:::|||||:
Human    71 QNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARM 135

  Fly   194 IYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLA 258
            |||||||||||:||||||||||::|||:::|..|.:::||:||||||||||:|||||||.:|:..
Human   136 IYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFV 200

  Fly   259 QLQDNSNAGSKADS 272
            :    |.|||.::|
Human   201 E----STAGSSSES 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 80/116 (69%)
RGS17NP_036551.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 3/10 (30%)
RGS 41..197 CDD:413378 92/156 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160292
Domainoid 1 1.000 183 1.000 Domainoid score I3425
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8242
Inparanoid 1 1.050 242 1.000 Inparanoid score I3331
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm41922
orthoMCL 1 0.900 - - OOG6_103880
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3135
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.