DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_593029.1 Gene:rgs1 / 2541764 PomBaseID:SPAC22F3.12c Length:481 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:38/135 - (28%)
Similarity:55/135 - (40%) Gaps:27/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SFDKLMKSTAGRK-----VFQNFLRSEFSEENILFWL-ACE------DLKKENSPELVEEK---A 191
            |.:|.:..|..||     .|..||:..|.:||..|:. .||      ...:.|..|.:.|.   |
pombe   339 STNKEILETILRKPNLQTYFFEFLKKNFCDENQRFYSEVCEFNDYFSHANETNDHEAIRESFAHA 403

  Fly   192 RLIYEDYISILSPREVSLDSRVREIVNRNM-----IEPTTHTFD-------EAQIQIYTLMHRDS 244
            ..||..::|..:|..|:|.|.:.|.:..:|     :||......       |||..:..||..||
pombe   404 CGIYNCFLSSNAPNAVNLPSDLYEKITNHMALAMEVEPLNEWLQLIHILLLEAQTAVLDLMAGDS 468

  Fly   245 YPRFL 249
            ..:||
pombe   469 LLKFL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 38/135 (28%)
rgs1NP_593029.1 DEP 59..156 CDD:214489
DEP_RGS7-like 224..309 CDD:239897
RGS_FLBA 344..480 CDD:188663 36/130 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.