DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs13

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_694811.1 Gene:Rgs13 / 246709 MGIID:2180585 Length:158 Species:Mus musculus


Alignment Length:176 Identity:62/176 - (35%)
Similarity:92/176 - (52%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CWCC-CCSCSWAKCLAIKNADENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKV 155
            ||.| .|            .||:.....:|           ||:|:..|.:|.:.||.:..|..|
Mouse     6 CWICKLC------------RDESKRLPSNL-----------TLDEVLKWAQSLESLMATKYGPIV 47

  Fly   156 FQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRN 220
            :..:|:.|.|:|||.||:|||..||..|......:|:.:|..||...||||:::||..||.:.::
Mouse    48 YTAYLKLEHSDENIKFWMACETYKKIASRRGRISRAKKLYNIYIQPQSPREINIDSTTREAIIKS 112

  Fly   221 MIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQ-LQDNSN 265
            :.|||...|:|||..:|..|..|||||||.|:.::.|.: :|..|:
Mouse   113 IREPTQTCFEEAQKIVYMHMEMDSYPRFLKSEMYQQLLKTVQSQSS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 49/116 (42%)
Rgs13NP_694811.1 RGS 36..148 CDD:383028 47/111 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.