DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs7

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006496891.1 Gene:Rgs7 / 24012 MGIID:1346089 Length:495 Species:Mus musculus


Alignment Length:146 Identity:55/146 - (37%)
Similarity:89/146 - (60%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARL 193
            ::|:.:.::.||...|:.:|...||:.|..||.||||.||:.||||.||||:....| |..:.:.
Mouse   320 KEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIRE-VPSRVQE 383

  Fly   194 IYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLA 258
            |::::::..:|..::|||:..:...:|:.||..:||::||..||.||..||||||:.|..::.| 
Mouse   384 IWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQEL- 447

  Fly   259 QLQDNSNAGSKADSPT 274
             ||....:|:..|..|
Mouse   448 -LQAKRKSGNSMDRRT 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 48/116 (41%)
Rgs7XP_006496891.1 DEP_RGS7-like 29..116 CDD:239897
RGS_DHEX 113..214 CDD:375589
GGL 256..316 CDD:128520
RGS_RGS7 326..446 CDD:188692 48/120 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.