DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs9

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_035398.2 Gene:Rgs9 / 19739 MGIID:1338824 Length:675 Species:Mus musculus


Alignment Length:137 Identity:51/137 - (37%)
Similarity:82/137 - (59%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPE 185
            :||:.:  |.||...:..|..:|.:|::...||:.||.||:.|||.||:.||.||||||..:..:
Mouse   280 LNAKLV--EIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSK 342

  Fly   186 LVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLN 250
             |:|||..||:.:::..:.|.:::|.:..:|..:.:..|..:..|.||..||.||.:|||.|:|.
Mouse   343 -VKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLK 406

  Fly   251 SQKFKTL 257
            |..:|.:
Mouse   407 SPIYKEM 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 45/116 (39%)
Rgs9NP_035398.2 DEP_RGS7-like 22..109 CDD:239897
GGL 219..280 CDD:128520 51/137 (37%)
RGS_RGS9 292..412 CDD:188693 45/120 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..571
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 637..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.