DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs5

DIOPT Version :10

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_033089.2 Gene:Rgs5 / 19737 MGIID:1098434 Length:181 Species:Mus musculus


Alignment Length:128 Identity:60/128 - (46%)
Similarity:94/128 - (73%) Gaps:0/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLI 194
            :|:|||:..|.:|.|||::::.|...|::||:|||||||:.||:|||:.||..||..:.|||:.|
Mouse    52 KPSLEEVLQWRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQI 116

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            ||::|...:|:||::|...::|..:|::||:..:||.||.:||.||.:||.|||:.|:.:|.|
Mouse   117 YEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALMEKDSLPRFVRSEFYKEL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 54/116 (47%)
Rgs5NP_033089.2 RGS_RGS5 65..178 CDD:188672 52/112 (46%)

Return to query results.
Submit another query.