DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs2

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_033087.2 Gene:Rgs2 / 19735 MGIID:1098271 Length:211 Species:Mus musculus


Alignment Length:130 Identity:57/130 - (43%)
Similarity:89/130 - (68%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLI 194
            :|:.||.:.|.::||:|:.|..|...|:.||:|||.||||.|||||||.||..||:.:..|||.|
Mouse    71 KPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKI 135

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQ 259
            |.|:|...:|:|:::|.:.:.::.:|:.|.|:..|..||.::|:||..:||||||.|:.::.|.:
Mouse   136 YTDFIEKEAPKEINIDFQTKSLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCK 200

  Fly   260  259
            Mouse   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 53/116 (46%)
Rgs2NP_033087.2 Necessary for membrane association. /evidence=ECO:0000250|UniProtKB:P41220 32..66
Necessary to inhibit protein synthesis. /evidence=ECO:0000250|UniProtKB:P41220 79..116 19/36 (53%)
RGS_RGS2 84..197 CDD:188664 52/112 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.