DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs2

DIOPT Version :10

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_033087.2 Gene:Rgs2 / 19735 MGIID:1098271 Length:211 Species:Mus musculus


Alignment Length:130 Identity:57/130 - (43%)
Similarity:89/130 - (68%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLI 194
            :|:.||.:.|.::||:|:.|..|...|:.||:|||.||||.|||||||.||..||:.:..|||.|
Mouse    71 KPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKI 135

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQ 259
            |.|:|...:|:|:::|.:.:.::.:|:.|.|:..|..||.::|:||..:||||||.|:.::.|.:
Mouse   136 YTDFIEKEAPKEINIDFQTKSLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCK 200

  Fly   260  259
            Mouse   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 53/116 (46%)
Rgs2NP_033087.2 Necessary for membrane association. /evidence=ECO:0000250|UniProtKB:P41220 32..66
Necessary to inhibit protein synthesis. /evidence=ECO:0000250|UniProtKB:P41220 79..116 19/36 (53%)
RGS_RGS2 84..197 CDD:188664 52/112 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.