DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs-2

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001379248.1 Gene:rgs-2 / 181414 WormBaseID:WBGene00004345 Length:181 Species:Caenorhabditis elegans


Alignment Length:169 Identity:93/169 - (55%)
Similarity:116/169 - (68%) Gaps:7/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 CCCSCSWAK---CLAIKNADENAPTKRDLVNAEFLDGEQ---PTLEEIRSWGKSFDKLMKSTAGR 153
            |..|| :.|   |:...::....|.....|:.|..:.|.   ||.|.:..|.:||:.|||..||:
 Worm     3 CAISC-FGKIIVCVTHNSSPSGKPYVSGSVSVEKKNQENDGPPTYEIVFGWSQSFENLMKHRAGQ 66

  Fly   154 KVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVN 218
            |.|..||:.|:|:||||||.|||:||:|.:.|.:|||||:||||:||||||:|||||||||||||
 Worm    67 KYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVN 131

  Fly   219 RNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            .||..|:..||||||.||||||.||||||||.|..:||:
 Worm   132 TNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 79/116 (68%)
rgs-2NP_001379248.1 RGS 52..169 CDD:413378 79/116 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I2383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm14608
orthoMCL 1 0.900 - - OOG6_103880
Panther 1 1.100 - - LDO PTHR10845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3135
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.950

Return to query results.
Submit another query.