DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs-7

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001360776.1 Gene:rgs-7 / 180645 WormBaseID:WBGene00004350 Length:824 Species:Caenorhabditis elegans


Alignment Length:147 Identity:52/147 - (35%)
Similarity:86/147 - (58%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKK-ENSPELVEEKARLI 194
            |:.:::|.|..||:.|:.:..|..:|:.||:.|||:||:.|||.||:.|| ::..:...:||..|
 Worm   676 PSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEI 740

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEP--TTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            |.::::..||:||:|||..| ...:..:|.  ...||..||.::..||.:|||.|||..:.|..|
 Worm   741 YSEFVAEHSPKEVNLDSDTR-AATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDL 804

  Fly   258 AQLQDNSNAGSKADSPT 274
            .:..:.::   |.|.|:
 Worm   805 LESYEITD---KEDKPS 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 46/119 (39%)
rgs-7NP_001360776.1 C2 310..427 CDD:214577
RGS 687..792 CDD:366196 39/105 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.