DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs-9

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_508350.1 Gene:rgs-9 / 180506 WormBaseID:WBGene00004352 Length:235 Species:Caenorhabditis elegans


Alignment Length:131 Identity:37/131 - (28%)
Similarity:60/131 - (45%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EEIRSWGKSFDKLMKST-AGRKVFQNFLRSEFSEENILFWLACEDLK----KENSPELVEEKARL 193
            |:|.||.||...|..|. .|..:...||:.:.|::.:.|||...:.:    |......:|  |:.
 Worm    98 EDILSWKKSPHSLAASEYGGSDLLVQFLKQQTSDDYVDFWLESGEYRWTRTKPGRKRDIE--AQR 160

  Fly   194 IYEDYISILSPREVS-LDSRVREIVNRNMIEPT-THTFDEAQIQIYTLMHRDSYPRFLNSQKFKT 256
            ||:.::....||::: |:...  .|:|.  .|| ...|..||..:.|...:|||.:||....:..
 Worm   161 IYDKFVYGECPRKIAHLEKMC--FVSRQ--GPTGRDVFICAQAYVGTNFPKDSYKKFLQDPIYLN 221

  Fly   257 L 257
            |
 Worm   222 L 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 33/123 (27%)
rgs-9NP_508350.1 RGS 106..222 CDD:214613 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.