DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs-1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001255056.1 Gene:rgs-1 / 176415 WormBaseID:WBGene00004344 Length:247 Species:Caenorhabditis elegans


Alignment Length:168 Identity:90/168 - (53%)
Similarity:114/168 - (67%) Gaps:16/168 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CWCCCCSCSWAKCLAIKNADENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVF 156
            |||        ..|..|.:...:|.:.  |..|.|     :.|.:.||.:|||.||...:|:|.|
 Worm     6 CWC--------SNLGRKYSGTVSPQRS--VQPEAL-----SYEMVYSWQQSFDTLMSFKSGQKCF 55

  Fly   157 QNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNM 221
            ..||:||:|:||||||.|||:||:|.:.|.:|||||:||||:||||||:||||||:||||||.||
 Worm    56 AEFLKSEYSDENILFWQACEELKREKNSEKMEEKARIIYEDFISILSPKEVSLDSKVREIVNTNM 120

  Fly   222 IEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFK-TLA 258
            ..||.:||::||.|||.||.||||||||.|..:: |||
 Worm   121 SRPTQNTFEDAQHQIYQLMARDSYPRFLTSIFYRETLA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 76/117 (65%)
rgs-1NP_001255056.1 RGS 38..154 CDD:383028 76/115 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I2383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm14608
orthoMCL 1 0.900 - - OOG6_103880
Panther 1 1.100 - - O PTHR10845
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.