DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs-3

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_495223.1 Gene:rgs-3 / 174020 WormBaseID:WBGene00004346 Length:363 Species:Caenorhabditis elegans


Alignment Length:187 Identity:48/187 - (25%)
Similarity:83/187 - (44%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 AIKNADENAPTKRDLVNAEFLDGEQ--PTLEEIR------------------------------- 137
            :|..:..:..:.|:.|.:|.||.|:  |.::|:|                               
 Worm   171 SINLSSSSMKSLRNAVASETLDMEEFAPAIKEVRRLLENDQFPRFRRSELYLEYLEELLPRSYAE 235

  Fly   138 SWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLK-KENSPELVEEKARLIYEDYISI 201
            .|.:||:.|:.:..||..|:.||||..:|||:.||.|..:.: ..:....:....::|...|::.
 Worm   236 KWAQSFEGLLGNHVGRHHFRIFLRSIHAEENLRFWEAVVEFRSSRHKANAMNNLGKVILSTYLAE 300

  Fly   202 LSPREVSLDSRVREIVNR----NMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKF 254
            .:..||.|...||:::.|    |.|:.|  .||||...:..::..|.|.|||.|.::
 Worm   301 GTTNEVFLPFGVRQVIERRIQDNQIDIT--LFDEAIKHVEQVLRNDPYVRFLQSSQY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 38/121 (31%)
rgs-3NP_495223.1 RGS 112..218 CDD:214613 10/46 (22%)
RGS 240..358 CDD:279009 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10845
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.