Sequence 1: | NP_611271.3 | Gene: | Dhit / 37037 | FlyBaseID: | FBgn0028743 | Length: | 274 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_740904.1 | Gene: | eat-16 / 172823 | WormBaseID: | WBGene00001145 | Length: | 473 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 64/197 - (32%) |
---|---|---|---|
Similarity: | 98/197 - (49%) | Gaps: | 39/197 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 PQSQKPCCFCWCCCCSCSWAKCLAIKNADENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLM 147
Fly 148 KSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSR 212
Fly 213 VREIVNRNMIEPTTHTFDEAQIQ---------IYTLMHRDSYPRFLNSQKFK---TLAQLQDNSN 265
Fly 266 AG 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dhit | NP_611271.3 | RGS_RZ-like | 139..256 | CDD:188673 | 47/128 (37%) |
eat-16 | NP_740904.1 | DEP_RGS7-like | 18..94 | CDD:239897 | |
GGL | 204..266 | CDD:128520 | 5/30 (17%) | ||
RGS_R7-like | 280..405 | CDD:188660 | 46/129 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000119 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |