DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and eat-16

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_740904.1 Gene:eat-16 / 172823 WormBaseID:WBGene00001145 Length:473 Species:Caenorhabditis elegans


Alignment Length:197 Identity:64/197 - (32%)
Similarity:98/197 - (49%) Gaps:39/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PQSQKPCCFCWCCCCSCSWAKCLAIKNADENAPTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLM 147
            ||...|    |....:..|           |.||  |..:||.     ||.:.::.||.|..:|:
 Worm   250 PQPSNP----WISDEASFW-----------NQPT--DTSSAEI-----PTEKRVKRWGLSVQELV 292

  Fly   148 KSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSR 212
            |...||:|.:.||.||||.|||.||:|.:|||...: |.:.:||..|.|::::..:|.:|::|:|
 Worm   293 KDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPN-EQIYQKAERIREEFLAQGAPAQVNVDNR 356

  Fly   213 VREIVNRNMIEPTTHTFDEAQIQ---------IYTLMHRDSYPRFLNSQKFK---TLAQLQDNSN 265
            ..:    ..:|..:...|.:|::         ::|||.:||||||:.||.:|   |.||......
 Worm   357 TLD----QTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAAQQHGTKR 417

  Fly   266 AG 267
            .|
 Worm   418 LG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 47/128 (37%)
eat-16NP_740904.1 DEP_RGS7-like 18..94 CDD:239897
GGL 204..266 CDD:128520 5/30 (17%)
RGS_R7-like 280..405 CDD:188660 46/129 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.