DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Axin2

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_056547.3 Gene:Axin2 / 12006 MGIID:1270862 Length:840 Species:Mus musculus


Alignment Length:211 Identity:49/211 - (23%)
Similarity:82/211 - (38%) Gaps:60/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GVSPTVGGSVGILGSTSNVLQESNATTFQ----RPQSQKPCCFCWCCCCSCSWAKCLAIKNADEN 113
            |.:|....|||.:.||..:...|||...:    .|:.:                       |..:
Mouse    31 GETPPCQPSVGKVQSTKPMPVSSNARRNEDGLGEPEGR-----------------------ASPD 72

  Fly   114 APTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDL 178
            :|..|                    |.||...|:....|..:|:.||..|...:.:.||.||...
Mouse    73 SPLTR--------------------WTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGF 117

  Fly   179 KKENSPELVEEK----ARLIYEDYI---SILSPR-EVSLDSRVREIVNRNMIEPTTHTFDEAQIQ 235
            ::.|   |.:.|    |:.||:.||   |::|.: :.:..:.:|:.:.:..|...  .||:||.:
Mouse   118 RQMN---LKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSV--MFDQAQTE 177

  Fly   236 IYTLMHRDSYPRFLNS 251
            |..:|..::|..||.|
Mouse   178 IQAVMEENAYQVFLTS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 35/121 (29%)
Axin2NP_056547.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 12/66 (18%)
AXIN1_TNKS_BD 10..73 CDD:374700 12/64 (19%)
Tankyrase-binding motif 21..30
RGS_Axin 82..198 CDD:188662 32/117 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363
Interaction with GSK3B. /evidence=ECO:0000250 327..413
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..435
Interaction with beta-catenin. /evidence=ECO:0000250 413..478
Axin_b-cat_bind 432..467 CDD:370146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 572..614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..745
DAX 758..840 CDD:197474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.