DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs14

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_446216.1 Gene:Rgs14 / 114705 RGDID:620003 Length:544 Species:Rattus norvegicus


Alignment Length:161 Identity:52/161 - (32%)
Similarity:84/161 - (52%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACE---DLKKENS 183
            ::.|...|||    :.||.:||::|::...|...|..||:.|||.||:.||.|||   .:...::
  Rat    51 SSPFSTDEQP----VASWAQSFERLLQDPRGLAYFTEFLKKEFSAENVTFWQACERFQQIPASDT 111

  Fly   184 PELVEEKARLIYEDYIS--ILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYP 246
            .:|.:| |..||.:::|  .|||..:...:.:.|.|   :.:|....|...|:||:.||..|||.
  Rat   112 KQLAQE-AHNIYHEFLSSQALSPVNIDRQAWLSEEV---LAQPRPDMFRAQQLQIFNLMKFDSYA 172

  Fly   247 RFLNSQKFK--TLAQLQ-------DNSNAGS 268
            ||:.|..::  .||:.:       .:|:.||
  Rat   173 RFVKSPLYQECLLAEAEGRPLREPGSSHLGS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 42/123 (34%)
Rgs14NP_446216.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..59 1/7 (14%)
RGS_RGS14 58..186 CDD:188697 46/135 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..220 3/13 (23%)
Necessary for interaction with RABGEF1. /evidence=ECO:0000250 297..424
RGS12_RBD 301..374 CDD:176412
UBQ 382..443 CDD:294102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..493
GoLoco 497..519 CDD:214645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.