DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and RGS19

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_011526786.1 Gene:RGS19 / 10287 HGNCID:13735 Length:246 Species:Homo sapiens


Alignment Length:256 Identity:122/256 - (47%)
Similarity:155/256 - (60%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GGSLGGVSPTVGGSVGILGSTSNVLQE----------------------SNATTFQRPQSQKPCC 90
            |..||   |::||  |.....|::|.:                      |:.|......|:.|||
Human    10 GPHLG---PSLGG--GARSCCSSLLNDPGPPPSPAITGPEEADRPPSMSSHDTASPAAPSRNPCC 69

  Fly    91 FCWCCCCSCSWAKCLAIKNADENAPTKR-----------DLVNAEFLDGEQPTLEEIRSWGKSFD 144
            .||||||||||           |...:|           .|.:.|..  ..|:.||::||.:|||
Human    70 LCWCCCCSCSW-----------NQERRRAWQASRESKLQPLPSCEVC--ATPSPEEVQSWAQSFD 121

  Fly   145 KLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSL 209
            |||.|.|||.||:.|||:|:||||:|||||||:||.|.:..:|:||||||||||:|||||:||||
Human   122 KLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSL 186

  Fly   210 DSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQLQDNSNAGSKA 270
            ||||||.:|:.|.||:.||||:||:|||||||||||||||:|..::.|. ||..|.:.|:|
Human   187 DSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALL-LQGPSQSSSEA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 83/116 (72%)
RGS19XP_011526786.1 RGS_RGS19 116..233 CDD:188699 83/116 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 183 1.000 Domainoid score I3425
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47786
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103880
Panther 1 1.100 - - LDO PTHR10845
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.